PDB entry 6i41

View 6i41 on RCSB PDB site
Description: Co-crystal structure of human SPOP MATH domain (wild-type) and human BRD3 fragment
Class: ligase
Keywords: ligase nuclear cancer ubiquitination, LIGASE
Deposited on 2018-11-08, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43791 (6-144)
      • expression tag (3-5)
    Domains in SCOPe 2.08: d6i41a1, d6i41a2
  • Chain 'B':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD3, KIAA0043, RING3L
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6i41A (A:)
gamasgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeesk
dylslylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdf
lldeangllpddkltlfcevsvvqd

    Sequence, based on observed residues (ATOM records): (download) 
    >6i41A (A:)
asgkvvkfsymwtinnfsfcregeviksstfssgandklkwclrvnpkgldeeskdylsl
ylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldea
ngllpddkltlfcevsvvqd

  • Chain 'B':
    No sequence available.