PDB entry 6i3t

View 6i3t on RCSB PDB site
Description: Crystal structure of murine neuroglobin bound to CO at 40 K.
Class: oxygen transport
Keywords: Oxygen transport/storage, carbon monoxide, photodissociation, OXYGEN TRANSPORT
Deposited on 2018-11-07, released 2019-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (Start-149)
      • engineered mutation (54)
      • engineered mutation (119)
    Domains in SCOPe 2.08: d6i3ta_
  • Heterogens: HEM, CMO, FMT, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6i3tA (A:)
merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe
fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleks
lgpdftpatrtawsrlygavvqamsrgwdg

    Sequence, based on observed residues (ATOM records): (download) 
    >6i3tA (A:)
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg