PDB entry 6i3r

View 6i3r on RCSB PDB site
Description: structure, dynamics and rox2-lncrna binding of tandem double-stranded rna binding domains dsrbd1/2 of drosophila helicase mle
Deposited on 2018-11-07, released 2019-02-20
The last revision was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dosage compensation regulator
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: mle, nap, CG11680
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24785 (2-258)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6i3rA (A:)
gamdiksflyqfcaksqiepkfdirqtgpknrqrflcevrvepntyigvgnstnkkdaek
nacrdfvnylvrvgklntndvpadagasgggprtglegagmaggsgqqkrvfdgqsgpqd
lgeayrplnhdggdggnrysvidriqeqrdmneaeafdvnaaihgnwtienakerlniyk
qtnnirddykytpvgpeharsflaelsiyvpalnrtvtaresgsnkksaskscalslvrq
lfhlnviepfsgtlkkkkd