PDB entry 6i2v

View 6i2v on RCSB PDB site
Description: pilotin from vibrio vulnificus type 2 secretion system, epss.
Deposited on 2018-11-02, released 2019-04-10
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Vibrio vulnificus [TaxId:672]
    Gene: CRN52_08940, CRN59_22290, FORC17_1995, FORC36_0970
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1PE, EDO, SO3, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i2vA (A:)
gsssngekerqlelmasnragvlsaglpieygplkvmrissskniveimmiyntdatgak
ptqellstsvskycedatvrnqldmglmyrikirnsrgqliidemvtaascqpq

    Sequence, based on observed residues (ATOM records):
    >6i2vA (A:)
ngekerqlelmasnragvlsaglpieygplkvmrissskniveimmiyntdatgakptqe
llstsvskycedatvrnqldmglmyrikirnsrgqliidemvtaascqpq