PDB entry 6i2s
View 6i2s on RCSB PDB site
Description: Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (R802A) in complex with GarA, following 2-oxoglutarate soak
Class: oxidoreductase
Keywords: oxoglutarate dehydrogenase, decarboxylase, OXIDOREDUCTASE
Deposited on
2018-11-01, released
2019-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-05-22, with a file datestamp of
2019-05-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: multifunctional 2-oxoglutarate metabolism enzyme
Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
Gene: kgd, sucA, MSMEG_5049, MSMEI_4922
Database cross-references and differences (RAF-indexed):
- Uniprot A0R2B1 (1-867)
- engineered mutation (442)
- Chain 'B':
Compound: Glycogen accumulation regulator GarA
Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
Gene: garA, MSMEG_3647, MSMEI_3561
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6i2sb_ - Heterogens: MG, CA, PO4, TD6, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>6i2sB (B:)
gsgveglpsgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrle
ggefqvvdvgslngtyvnrepvdsavlangdevqigkfrlvfltgpksddsgsna
Sequence, based on observed residues (ATOM records): (download)
>6i2sB (B:)
psgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrleggefqvv
dvgslngtyvnrepvdsavlangdevqigkfrlvflt