PDB entry 6i2s

View 6i2s on RCSB PDB site
Description: Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (R802A) in complex with GarA, following 2-oxoglutarate soak
Class: oxidoreductase
Keywords: oxoglutarate dehydrogenase, decarboxylase, OXIDOREDUCTASE
Deposited on 2018-11-01, released 2019-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: multifunctional 2-oxoglutarate metabolism enzyme
  Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
  Gene: kgd, sucA, MSMEG_5049, MSMEI_4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0R2B1 (1-867)
    • engineered mutation (442)
• Chain 'B':
  Compound: Glycogen accumulation regulator GarA
  Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
  Gene: garA, MSMEG_3647, MSMEI_3561
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0QYG2
  Domains in SCOPe 2.08: d6i2sb_
• Heterogens: MG, CA, PO4, TD6, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6i2sB (B:)
  gsgveglpsgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrle
  ggefqvvdvgslngtyvnrepvdsavlangdevqigkfrlvfltgpksddsgsna
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6i2sB (B:)
  psgsallvvkrgpnagsrflldqpttsagrhpdsdiflddvtvsrrhaefrleggefqvv
  dvgslngtyvnrepvdsavlangdevqigkfrlvflt