PDB entry 6i2o

View 6i2o on RCSB PDB site
Description: solution nmr structure of pile1 from streptococcus sanguinis
Deposited on 2018-11-01, released 2019-03-13
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type IV pilin PilE1
    Species: Streptococcus sanguinis [TaxId:1305]
    Gene: pilE1, SSV_2241
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6i2oA (A:)
    hqdnarksriqsehrelvsaiqsyigaqddptnpseitlaklapymsknaknedgivnsl
    akdksgnsstsapgsahqidttnhklistftpsnggqatvltydwsangvnsn