PDB entry 6i2h

View 6i2h on RCSB PDB site
Description: crystal structure of the protein-kinase a catalytic subunit from cricetulus griseus in complex with compounds rkp182 and rkp190
Deposited on 2018-11-01, released 2019-11-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Cricetulus griseus [TaxId:10029]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25321 (2-352)
      • expression tag (0-1)
  • Chain 'D':
    Compound: UPF0418 protein FAM164A
    Species: Cricetulus griseus, synthetic [TaxId:10029]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3HK48 (0-17)
      • conflict (12)
      • conflict (15)
  • Heterogens: AO8, RIP, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6i2hA (A:)
    ghmgnaaaakkgseqesvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrv
    mlvkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnly
    mvmeyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqq
    gyiqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagypp
    ffadqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwf
    attdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6i2hD (D:)
    ttyadfiasgrtsrrdai