PDB entry 6i25

View 6i25 on RCSB PDB site
Description: Flavin Analogue Sheds Light on Light-Oxygen-Voltage Domain Mechanism
Class: transcription
Keywords: LOV Domain, FMN, Dark grown, fluorescence, light sensing, transcription factor PAS domain, Ochronomas danica, transcription
Deposited on 2018-10-31, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Aureochrome1-like protein
  Species: Ochromonas danica [TaxId:2986]
  Gene: OdAUREO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot C5NSW6 (3-134)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d6i25a1, d6i25a2
• Heterogens: CL, MG, 5DD, 9O9, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6i25A (A:)
  gamdyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpe
  tdpkavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvs
  edyakaflkneenek