PDB entry 6i24

View 6i24 on RCSB PDB site
Description: Flavin Analogue Sheds Light on Light-Oxygen-Voltage Domain Mechanism
Class: transcription
Keywords: LOV Domain, FMN, Dark grown, fluorescence, light sensing, transcription factor PAS domain, Ochronomas danica, transcription
Deposited on 2018-10-31, released 2019-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aureochrome1-like protein
    Species: Ochromonas danica [TaxId:2986]
    Gene: OdAUREO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5NSW6 (3-134)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d6i24a1, d6i24a2
  • Heterogens: ACT, CL, MG, EDO, PEG, 5DD, 9O9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i24A (A:)
    gamdyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpe
    tdpkavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvs
    edyakaflkneenek