PDB entry 6i1y

View 6i1y on RCSB PDB site
Description: vibrio vulnificus epsd
Deposited on 2018-10-30, released 2019-04-10
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: General secretion pathway protein GspD
    Species: Vibrio vulnificus [TaxId:672]
    Gene: JS86_21435
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i1yA (A:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yA (A:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6i1yB (B:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yB (B:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6i1yC (C:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yC (C:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6i1yD (D:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yD (D:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6i1yE (E:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yE (E:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6i1yF (F:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yF (F:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6i1yG (G:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yG (G:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6i1yH (H:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yH (H:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6i1yI (I:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yI (I:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6i1yJ (J:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yJ (J:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6i1yK (K:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yK (K:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6i1yL (L:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yL (L:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6i1yM (M:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yM (M:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6i1yN (N:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yN (N:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >6i1yO (O:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnrttdakntpeflqpklvadertnsilisg
    dpkvrdrlkrlirqldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqaeknsgqkga
    ssqrndvviaahqgtnslvltappdimlalqevitqldirraqvliealivemaegdgvn
    lgvqwgnletgaviqysntgtpigkvmvgleeakdktvtdsrwnsdtdkyepysrteagd
    ystlaaalagvngaamslvmgdwtalisavssdsnsnilsspsitvmdngeasfivgeev
    pvitgstagsnndnpfqtvdrkevgiklkvvpqinegdsvqlnieqevsnvlgangavdv
    rfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqvekkn
    lmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedkrhp
    aeiqafidqmeqq
    

    Sequence, based on observed residues (ATOM records):
    >6i1yO (O:)
    dnvitrvvavrnvsvrelspllrqlidnagagnvvhydpaniilitgraavvnrlaeiik
    rvdqagnreievvelgnasaaemvrivdalnklvadertnsilisgdpkvrdrlkrlirq
    ldvemaskgnnrvvylkyakaedlvdvlkgvsdnlqavviaahqgtnslvltappdimla
    lqevitqldirraqvliealivemaegdgvnlgvqwgnletgaviqysntgtpigkvmvg
    leeakdktvtsrteagdystlaaalagvngaamslvmgdwtalisavssdsnsnilssps
    itvmdngeasfivgeevpvitvdrkevgiklkvvpqinegdsvqlnieqevsnvlganga
    vdvrfakrqlntsvivqdgqmlvlgglideraleseskvpllgdipilghlfkstntqve
    kknlmvfikptiirdgmtadgitqrkynyiraeqlykaeqglklmddghipvlpkfgedk
    rhpaeiqafidqmeqq