PDB entry 6i1d

View 6i1d on RCSB PDB site
Description: Structure of the Ysh1-Mpe1 nuclease complex from S.cerevisiae
Class: gene regulation
Keywords: pre-mRNA, mRNA, nuclease, endonuclease, cleavage, polyadenylation, polyA, CPF, metallo-beta-lactamase, 3' ends, GENE REGULATION
Deposited on 2018-10-28, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoribonuclease YSH1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YSH1, BRR5, YLR277C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6i1da_
  • Chain 'B':
    Compound: Protein MPE1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: MPE1, YKL059C, YKL316
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35728
      • conflict (97)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6i1dA (A:)
    mertntttfkffslggsnevgrschilqykgktvmldagihpayqglaslpfydefdlsk
    vdillishfhldhaaslpyvmqrtnfqgrvfmthptkaiyrwllrdfvrvtsigsssssm
    gtkdeglfsdedlvdsfdkietvdyhstvdvngikftafhaghvlgaamfqieiaglrvl
    ftgdysrevdrhlnsaevpplssnvlivestfgtatheprlnrerkltqlihstvmrggr
    vllpvfalgraqeimlildeywsqhadelgggqvpifyasnlakkcmsvfqtyvnmmndd
    irkkfrdsqtnpfifknisylrnledfqdfgpsvmlaspgmlqsglsrdllerwcpedkn
    lvlitgysiegtmakfimlepdtipsinnpeitiprrcqveeisfaahvdfqenlefiek
    isapniilvhgeanpmgrlksallsnfaslkgtdnevhvfnprncvevdlefqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6i1dA (A:)
    ntttfkffslggsnevgrschilqykgktvmldagihpayqglaslpfydefdlskvdil
    lishfhldhaaslpyvmqrtnfqgrvfmthptkaiyrwllrdfvrvtsigglfsdedlvd
    sfdkietvdyhstvdvngikftafhaghvlgaamfqieiaglrvlftgdysrevdrhlns
    aevpplssnvlivestfgtatheprlnrerkltqlihstvmrggrvllpvfalgraqeim
    lildeywsqhadelgggqvpifyasnlakkcmsvfqtyvnmmnddirkkfrdsqtnpfif
    knisylrnledfqdfgpsvmlaspgmlqsglsrdllerwcpedknlvlitgysiegtmak
    fimlepdtipsinnpeitiprrcqveeisfaahvdfqenlefiekisapniilvhgeanp
    mgrlksallsnfaslkgtdnevhvfnprncvevdlefq
    

  • Chain 'B':
    No sequence available.