PDB entry 6i1b

View 6i1b on RCSB PDB site
Description: high-resolution three-dimensional structure of interleukin-1 beta in solution by three-and four-dimensional nuclear magnetic resonance spectroscopy
Class: cytokine
Keywords: cytokine
Deposited on 1991-01-22, released 1992-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i1ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6i1bA (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvss