PDB entry 6i0q

View 6i0q on RCSB PDB site
Description: Crystal structure of BTB domain of KCTD16 hexamer
Class: structural protein
Keywords: KCTD, GABA(B) receptor, Receptor associated protein, STRUCTURAL PROTEIN
Deposited on 2018-10-26, released 2019-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing protein kctd16
    Species: Homo sapiens [TaxId:9606]
    Gene: KCTD16, KIAA1317
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i0qa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6i0qA (A:)
sfpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgfl
fryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp

    Sequence, based on observed residues (ATOM records): (download) 
    >6i0qA (A:)
sfpevvelnvggqvyftrhstlisiphsllwkmfspkandlakdskgrffidrdgflfry
ildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp