PDB entry 6i0i

View 6i0i on RCSB PDB site
Description: Structure of the streptomyces subtilisin and TAMP inhibitor (SSTI)
Class: antimicrobial protein
Keywords: MTG, microbial transglutaminase; SIL, SSI-like inhibitory protein; SSI, Streptomyces subtilisin inhibitor; SSTI, Streptomyces subtilisin and TAMP inhibitor; TAMP, transglutaminase-activating metalloprotease; TAP, tripeptidylaminopeptidase., ANTIMICROBIAL PROTEIN
Deposited on 2018-10-26, released 2019-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transglutaminase-activating metalloprotease inhibitor
    Species: Streptomyces mobaraensis NBRC 13819 = DSM 40847 [TaxId:1223523]
    Gene: sti
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i0ia_
  • Chain 'B':
    Compound: Transglutaminase-activating metalloprotease inhibitor
    Species: Streptomyces mobaraensis NBRC 13819 = DSM 40847 [TaxId:1223523]
    Gene: sti
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6i0ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6i0iA (A:)
yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki
ksgtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6i0iB (B:)
yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki
ksgtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef

    Sequence, based on observed residues (ATOM records): (download) 
    >6i0iB (B:)
yapsalvltvgqgdkaasagvqravtlncmpkpsgthpdargacdqlraasgnfaeitki
gtactkewnpfvvtaegvwegqrvkyehtfanpcemkagkgtvfef