PDB entry 6i0a

View 6i0a on RCSB PDB site
Description: crystal structure of rlpa spor domain from pseudomonas aeruginosa in complex with nuded glycan obtained by co-crystallization
Deposited on 2018-10-25, released 2019-11-13
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endolytic peptidoglycan transglycosylase RlpA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: rlpA, PAMH19_1027
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMU, AMV, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6i0aA (A:)
glylqvgafanpdaaellkaklsgvtaapvfissvvrnqqilhrvrlgpigsadevsrtq
dsirvanlgqptlvrpd