PDB entry 6i05

View 6i05 on RCSB PDB site
Description: crystal structure of rlpa spor domain from pseudomonas aeruginosa
Deposited on 2018-10-25, released 2019-11-13
The last revision was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endolytic peptidoglycan transglycosylase RlpA
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: rlpA, PAMH19_1027
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6i05A (A:)
adglylqvgafanpdaaellkaklsgvtaapvfissvvrnqqilhrvrlgpigsadevsr
tqdsirvanlgqptlvrpd

    Sequence, based on observed residues (ATOM records):
    >6i05A (A:)
glylqvgafanpdaaellkaklsgvtaapvfissvvrnqqilhrvrlgpigsadevsrtq
dsirvanlgqptlvrp