PDB entry 6hzh

View 6hzh on RCSB PDB site
Description: Apo structure of TP domain from Chlamydia trachomatis penicillin-binding protein 3
Class: peptide binding protein
Keywords: penicillin-binding protein, peptidoglycan, Transpeptidase, PEPTIDE BINDING PROTEIN
Deposited on 2018-10-23, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: pbp_2, ERS133248_00492
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E9FXJ8 (7-345)
      • expression tag (4-6)
      • engineered mutation (50-51)
    Domains in SCOPe 2.08: d6hzha1, d6hzha2
  • Chain 'B':
    Compound: penicillin-binding protein
    Species: Chlamydia trachomatis [TaxId:813]
    Gene: pbp_2, ERS133248_00492
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E9FXJ8 (7-345)
      • expression tag (4-6)
      • engineered mutation (50-51)
    Domains in SCOPe 2.08: d6hzhb1, d6hzhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hzhA (A:)
    gpgyqdpltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsai
    yepgsvgklvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiah
    syntgtvqigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfg
    qgvavttiqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvl
    nimqgatqpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiav
    avviykengtvygstasapvfvdiaqfamremkippstvplykypw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hzhA (A:)
    qdpltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsaiyepg
    svgklvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiahsynt
    gtvqigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfgqgva
    vttiqlaqmvavfgqkgvlippriidgygesrqvvsedtaqtvlnimqgatqpggtaegi
    gavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiavavviykengtvygsta
    sapvfvdiaqfamremkippstvplykypw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hzhB (B:)
    gpgyqdpltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsai
    yepgsvgklvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiah
    syntgtvqigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfg
    qgvavttiqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvl
    nimqgatqpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiav
    avviykengtvygstasapvfvdiaqfamremkippstvplykypw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hzhB (B:)
    qdpltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsaiyepg
    svgklvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiahsynt
    gtvqigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfgqgva
    vttiqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvlnimq
    gatqpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiavavvi
    ykengtvygstasapvfvdiaqfamremkippstvplykypw