PDB entry 6hz8

View 6hz8 on RCSB PDB site
Description: structure of mcrbc without dna binding domains (class 4)
Deposited on 2018-10-22, released 2019-07-24
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: EM
Resolution: 4.3 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 5-methylcytosine-specific restriction enzyme B
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrB, rglB, b4346, JW5871
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Protein McrC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrC, b4345, JW5789
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Protein McrC
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mcrC, b4345, JW5789
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, GDP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hz8A (A:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8A (A:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hz8B (B:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8B (B:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hz8C (C:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8C (C:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6hz8D (D:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8D (D:)
    lndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqfh
    qsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfgev
    mmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsfi
    diepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfccg
    ledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6hz8E (E:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8E (E:)
    alndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqf
    hqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfge
    vmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsf
    idiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfcc
    gledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6hz8F (F:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8F (F:)
    alndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqf
    hqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfge
    vmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsf
    idiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfcc
    gledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6hz8G (G:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8G (G:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6hz8H (H:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8H (H:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6hz8I (I:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8I (I:)
    ycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrv
    nmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranls
    kvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalr
    rrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrigh
    syfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6hz8J (J:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8J (J:)
    lndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqfh
    qsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfgev
    mmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsfi
    diepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfccg
    ledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6hz8K (K:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8K (K:)
    alndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqf
    hqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfge
    vmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsf
    idiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfcc
    gledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6hz8L (L:)
    msktesycledalndlfipettietilkrltikkniilqgppgvgktfvarrlaylltge
    kapqrvnmvqfhqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiidei
    nranlskvfgevmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslav
    vdyalrrrfsfidiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgk
    gfrighsyfccgledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllgdssg
    shhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hz8L (L:)
    alndlfipettietilkrltikkniilqgppgvgktfvarrlaylltgekapqrvnmvqf
    hqsysyedfiqgyrpngvgfrrkdgifynfcqqakeqpekkyifiideinranlskvfge
    vmmlmehdkrgenwsvpltysendeerfyvpenvyiiglmntadrslavvdyalrrrfsf
    idiepgfdtpqfrnfllnkkaepsfveslcqkmnelnqeiskeatilgkgfrighsyfcc
    gledgtspdtqwlneivmtdiaplleeyffddpykqqkwtnkllg
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6hz8M (M:)
    meqpvipvrniyymltyawgylqeikqanleaipgnnlldilgyvlnkgvlqlsrrglel
    dynpnteiipgikgriefaktirgfhlnhgktvstfdmlnedtlanriikstlailikhe
    klnstirdearslyrklpgistlhltpqhfsylnggkntryykfvisvckfivnnsipgq
    nkghyrfydfernekemsllyqkflyefcrreltsanttrsylkwdassisdqslnllpr
    metditirssekilivdakyyksifsrrmgtekfhsqnlyqlmnylwslkpengeniggl
    liyphvdtavkhrykingfdiglctvnlgqewpcihqelldifdeylk
    

    Sequence, based on observed residues (ATOM records):
    >6hz8M (M:)
    qpvipvrniyymltyawgyanleaipgnnlldilgyvlnkgvlqlsrrgleldynpntei
    ipgikgriefaktirgfhlnhgktvstfdmlnedtlanriikstlailikheklnstird
    earslyrklpgistlhltpqhfsylnggkntryykfvisvckfivnnsipgqnkghyrfy
    dfernekemsllyqkflyefcrreltsanttrsylkwdassisdqslnllprmetditir
    ssekilivdakyyksifsrekfhsqnlyqlmnylwslkpengenigglliyphvdtavkh
    rykingfdiglctvnlgqewpcihqelldifdeylk
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6hz8N (N:)
    meqpvipvrniyymltyawgylqeikqanleaipgnnlldilgyvlnkgvlqlsrrglel
    dynpnteiipgikgriefaktirgfhlnhgktvstfdmlnedtlanriikstlailikhe
    klnstirdearslyrklpgistlhltpqhfsylnggkntryykfvisvckfivnnsipgq
    nkghyrfydfernekemsllyqkflyefcrreltsanttrsylkwdassisdqslnllpr
    metditirssekilivdakyyksifsrrmgtekfhsqnlyqlmnylwslkpengeniggl
    liyphvdtavkhrykingfdiglctvnlgqewpcihqelldifdeylk
    

    Sequence, based on observed residues (ATOM records):
    >6hz8N (N:)
    qpvipvrniyymltyawgyanleaipgnnlldilgyvlnkgvlqlsrrgleldynpntei
    ipgikgriefaktirgfhlnhgktvstfdmlnedtlanriikstlailikheklnstird
    earslyrklpgistlhltpqhfsylnggkntryykfvisvckfivnnsipgqnkghyrfy
    dfernekemsllyqkflyefcrreltsanttrsylkwdassisdqslnllprmetditir
    ssekilivdakyyksifsrekfhsqnlyqlmnylwslkpengenigglliyphvdtavkh
    rykingfdiglctvnlgqewpcihqelldifdeylk