PDB entry 6hyo

View 6hyo on RCSB PDB site
Description: Structure of ULK1 LIR motif bound to GABARAP
Class: signaling protein
Keywords: Autophagy, ATG8, LIR, SIGNALING PROTEIN
Deposited on 2018-10-22, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase ULK1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75385 (Start-17)
      • linker (18-19)
    • Uniprot O95166 (20-136)
    Domains in SCOPe 2.08: d6hyoa_
  • Heterogens: GOL, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6hyoA (A:)
gptmgtddfvmvpaqfpggsmkfvykeehpfekrrsegekirkkypdrvpvivekapkar
igdldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehhe
edfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >6hyoA (A:)
ddfvmvpaqfpggsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldk
kkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffly
iaysdesvygl