PDB entry 6hye

View 6hye on RCSB PDB site
Description: PDX1.2/PDX1.3 complex (PDX1.3:K97A)
Class: plant protein
Keywords: Swinging arm lysine; Pseudoenzyme, Inactive mutant, dodecamer, PLANT PROTEIN
Deposited on 2018-10-20, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX12, A37, PDX1L2, At3g16050, MSL1.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hyea_
  • Chain 'B':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L940
      • engineered mutation (96)
    Domains in SCOPe 2.08: d6hyeb_
  • Chain 'C':
    Compound: Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX12, A37, PDX1L2, At3g16050, MSL1.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hyec_
  • Chain 'D':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L940
      • engineered mutation (96)
    Domains in SCOPe 2.08: d6hyed_
  • Chain 'E':
    Compound: Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX12, A37, PDX1L2, At3g16050, MSL1.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hyee_
  • Chain 'F':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L940
      • engineered mutation (96)
    Domains in SCOPe 2.08: d6hyef_
  • Chain 'G':
    Compound: Pyridoxal 5'-phosphate synthase-like subunit PDX1.2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX12, A37, PDX1L2, At3g16050, MSL1.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hyeg_
  • Chain 'H':
    Compound: Pyridoxal 5'-phosphate synthase subunit PDX1.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PDX13, GIP2, PDX1L3, RSR4, At5g01410, T10O8.120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L940
      • engineered mutation (96)
    Domains in SCOPe 2.08: d6hyeh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hyeA (A:)
    madqamtdqdqgavtlysgtaitdakknhpfsvkvglaqvlrggaivevssvnqaklaes
    agacsvivsdpvrsrggvrrmpdpvlikevkravsvpvmararvghfveaqileslavdy
    ideseiisvadddhfinkhnfrspficgcrdtgealrriregaamiriqgdltatgniae
    tvknvrslmgevrvlnnmdddevftfakkisapydlvaqtkqmgrvpvvqfasggittpa
    daalmmqlgcdgvfvgsevfdgpdpfkklrsivqavqhyndphvlaemssglenamesln
    vrgdriqdfgqgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeA (A:)
    pfsvkvglaqvlrggaivevssvnqaklaesagacsvivsdvrsrggvrrmpdpvlikev
    kravsvpvmararvghfveaqileslavdyideseiisvadddhfinkhnfrspficgcr
    dtgealrriregaamiriqgdltatgniaetvknvrslmgevrvlnnmdddevftfakki
    sapydlvaqtkqmgrvpvvqfasggittpadaalmmqlgcdgvfvgvfdgpdpfkklrsi
    vqavqhyndphvlaemssglenam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hyeB (B:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmaaarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrsehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeB (B:)
    pfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdpq
    mikeikqavtipvmaaarighfveaqileaigidyidesevltladedhhinkhnfripf
    vcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftf
    akklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgifksgdparr
    araivqavthysdpemlvevscglgeam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hyeC (C:)
    madqamtdqdqgavtlysgtaitdakknhpfsvkvglaqvlrggaivevssvnqaklaes
    agacsvivsdpvrsrggvrrmpdpvlikevkravsvpvmararvghfveaqileslavdy
    ideseiisvadddhfinkhnfrspficgcrdtgealrriregaamiriqgdltatgniae
    tvknvrslmgevrvlnnmdddevftfakkisapydlvaqtkqmgrvpvvqfasggittpa
    daalmmqlgcdgvfvgsevfdgpdpfkklrsivqavqhyndphvlaemssglenamesln
    vrgdriqdfgqgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeC (C:)
    pfsvkvglaqvlrggaivevssvnqaklaesagacsvivsdpggvrrmpdpvlikevkra
    vsvpvmararvghfveaqileslavdyideseiisvadddhfinkhnfrspficgcrdtg
    ealrriregaamiriqgdltatgniaetvknvrslmgevrvlnnmdddevftfakkisap
    ydlvaqtkqmgrvpvvqfasggittpadaalmmqlgcdgvfvgvfdgpdpfkklrsivqa
    vqhyndphvlaemssglenam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hyeD (D:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmaaarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrsehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeD (D:)
    pfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalerggvarmsdpqmikeikqa
    vtipvmaaarighfveaqileaigidyidesevltladedhhinkhnfripfvcgcrnlg
    ealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftfakklaapy
    dlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgifksgdparraraivqav
    thysdpemlvevscglgeam
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hyeE (E:)
    madqamtdqdqgavtlysgtaitdakknhpfsvkvglaqvlrggaivevssvnqaklaes
    agacsvivsdpvrsrggvrrmpdpvlikevkravsvpvmararvghfveaqileslavdy
    ideseiisvadddhfinkhnfrspficgcrdtgealrriregaamiriqgdltatgniae
    tvknvrslmgevrvlnnmdddevftfakkisapydlvaqtkqmgrvpvvqfasggittpa
    daalmmqlgcdgvfvgsevfdgpdpfkklrsivqavqhyndphvlaemssglenamesln
    vrgdriqdfgqgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeE (E:)
    hpfsvkvglaqvlrggaivevssvnqaklaesagacsvivsdpgvrrmpdpvlikevkra
    vsvpvmararvghfveaqileslavdyideseiisvadddhfinkhnfrspficgcrdtg
    ealrriregaamiriqgdltatgniaetvknvrslmgevrvlnnmdddevftfakkisap
    ydlvaqtkqmgrvpvvqfasggittpadaalmmqlgcdgvfvggpdpfkklrsivqavqh
    yndphvlaemssglenam
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hyeF (F:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmaaarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrsehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeF (F:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalergvarmsdpqmikeikqa
    vtipvmaaarighfveaqileaigidyidesevltladedhhinkhnfripfvcgcrnlg
    ealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftfakklaapy
    dlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgdparraraivqavthy
    sdpemlvevscglgeam
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hyeG (G:)
    madqamtdqdqgavtlysgtaitdakknhpfsvkvglaqvlrggaivevssvnqaklaes
    agacsvivsdpvrsrggvrrmpdpvlikevkravsvpvmararvghfveaqileslavdy
    ideseiisvadddhfinkhnfrspficgcrdtgealrriregaamiriqgdltatgniae
    tvknvrslmgevrvlnnmdddevftfakkisapydlvaqtkqmgrvpvvqfasggittpa
    daalmmqlgcdgvfvgsevfdgpdpfkklrsivqavqhyndphvlaemssglenamesln
    vrgdriqdfgqgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeG (G:)
    hpfsvkvglaqvlrggaivevssvnqaklaesagacsvivsdpggvrrmpdpvlikevkr
    avsvpvmararvghfveaqileslavdyideseiisvadddhfinkhnfrspficgcrdt
    gealrriregaamiriqgdltatgniaetvknvrslmgevrvlnnmdddevftfakkisa
    pydlvaqtkqmgrvpvvqfasggittpadaalmmqlgcdgvfvgvfdgpdpfkklrsivq
    avqhyndphvlaemssglenam
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hyeH (H:)
    megtgvvavygngaiteakkspfsvkvglaqmlrggvimdvvnaeqariaeeagacavma
    lervpadiraqggvarmsdpqmikeikqavtipvmaaarighfveaqileaigidyides
    evltladedhhinkhnfripfvcgcrnlgealrriregaamirtkgeagtgniieavrhv
    rsvngdirvlrnmdddevftfakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalm
    mqlgcdgvfvgsgifksgdparraraivqavthysdpemlvevscglgeamvginlndek
    verfanrsehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hyeH (H:)
    spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalerggvarmsdpqmikeikq
    avtipvmaaarighfveaqileaigidyidesevltladedhhinkhnfripfvcgcrnl
    gealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftfakklaap
    ydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgifksgdparraraivqa
    vthysdpemlvevscglgeam