PDB entry 6hy3

View 6hy3 on RCSB PDB site
Description: Three-dimensional structure of AgaC from Zobellia galactanivorans
Class: hydrolase
Keywords: Glycoside hydrolase, Zobellia galactanivorans, Agar, marine bacteria, red algae, HYDROLASE
Deposited on 2018-10-19, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-agarase C
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: agaC, zobellia_4267
    Database cross-references and differences (RAF-indexed):
    • Uniprot D7GXG5 (12-271)
      • expression tag (3-11)
    Domains in SCOPe 2.07: d6hy3a1, d6hy3a2
  • Heterogens: MG, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hy3A (A:)
    mgsshhhhhhgstydftgntpppapqgmkwvkisqlsdefnngfntdkwtkslwnygvpv
    qmkaensgvsdgklwikatlgndperwfetsrvmskaqvnypmytvsrikgahisayntf
    wlnngnisnrneidviennsnpscncqpdfpwqmnsqyfhvvnddtkrnkgnfdnrelsd
    anplkgvawneeyhtfgvwwkdathiqfyldgepagsvvsardftrelniiwdlwtvdad
    wlgglakkehlsnnnintmkidwihtyqlvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hy3A (A:)
    shhhhhhgstydftgntpppapqgmkwvkisqlsdefnngfntdkwtkslwnygvpvqmk
    aensgvsdgklwikatlgndperwfetsrvmskaqvnypmytvsrikgahisayntfwln
    ngnisnrneidviennsnpscncqpdfpwqmnsqyfhvvnddtkrnkgnfdnrelsdanp
    lkgvawneeyhtfgvwwkdathiqfyldgepagsvvsardftrelniiwdlwtvdadwlg
    glakkehlsnnnintmkidwihtyqlvee