PDB entry 6hxu

View 6hxu on RCSB PDB site
Description: Crystal structure of Human RHOB Q63L in complex with GTP
Class: immune system
Keywords: GTPase, RHO, antibody, complex, immune system
Deposited on 2018-10-18, released 2019-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-related GTP-binding protein RhoB
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOB, ARH6, ARHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62745 (Start-182)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d6hxua_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hxuA (A:)
    maairkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdt
    agledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkd
    lrsdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalq
    kry
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hxuA (A:)
    aairkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdta
    gledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdl
    rsdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqk
    ry