PDB entry 6hxe

View 6hxe on RCSB PDB site
Description: Crystal structure of psychrophilic phosphoglycerate kinase from Pseudomonas TACII18 in complex with 3-phosphoglycerate
Class: transferase
Keywords: Complex, 3-phosphoglycerate, hinge binding, TRANSFERASE
Deposited on 2018-10-17, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Pseudomonas sp. 'TAC II 18' [TaxId:76981]
    Gene: PGK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RBS3 (Start-386)
      • conflict (149)
      • conflict (218)
      • conflict (357)
    Domains in SCOPe 2.08: d6hxea_
  • Heterogens: 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hxeA (A:)
    mtvlkmtdldlqgkrvliredlnvpvkdgvvtsdarilaslptiklalekgaavmvcshl
    grptegefsaenslkpvadylskalgrevplvsdylngvdvkagdivlfenvrfnkgekk
    nadelakqyaalcdvfvmdafgtahraegsthgvakfakvaaagpllaaeldalgkalga
    pakpmaaivagskvstkldvlnslsqicdllivgggiadtflaaaghpvgkslyepdlld
    taraiaakvnvplptdvvvakefaesaeatvkliadvaaddmildigpqtaehfaqllkt
    sktilwngpvgvfefdqfgngtkvlakaiadsaafsiagggdtlaaidkygvadqisqis
    tgggaflefvegkvlpavevlesraka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hxeA (A:)
    tvlkmtdldlqgkrvliredlnvpvkdgvvtsdarilaslptiklalekgaavmvcshlg
    rptegefsaenslkpvadylskalgrevplvsdylngvdvkagdivlfenvrfnkgekkn
    adelakqyaalcdvfvmdafgtahraegsthgvakfakvaaagpllaaeldalgkalgap
    akpmaaivagskvstkldvlnslsqicdllivgggiadtflaaaghpvgkslyepdlldt
    araiaakvnvplptdvvvakefaesaeatvkliadvaaddmildigpqtaehfaqllkts
    ktilwngpvgvfefdqfgngtkvlakaiadsaafsiagggdtlaaidkygvadqisqist
    gggaflefvegkvlpavevlesraka