PDB entry 6hwu

View 6hwu on RCSB PDB site
Description: Crystal structure of p38alpha in complex with a photoswitchable 2-Azothiazol-based Inhibitor (compound 2)
Class: transferase
Keywords: p38alpha, MAPK14, photoswitchable, Azothiazol, Transferase
Deposited on 2018-10-15, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hwua_
  • Heterogens: GE5, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hwuA (A:)
    gshsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hwuA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfglvatrwyrapeimlnwmhy
    nqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiq
    sltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepva
    dpydqsfesrdllidewksltydevisfvpppl