PDB entry 6hwr

View 6hwr on RCSB PDB site
Description: red kidney bean purple acid phosphatase in complex with adenosine divanadate
Deposited on 2018-10-13, released 2019-04-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Fe(3+)-Zn(2+) purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (0-425)
      • conflict (357)
  • Heterogens: ZN, FE, SO4, GOL, EDO, PGE, NAG, NA, H1T, VV6, H1Q, H1W, IPA, VN3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.05, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hwrA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records):
    >6hwrA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvdd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hwrB (B:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records):
    >6hwrB (B:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vddst
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hwrC (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records):
    >6hwrC (C:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    dds
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6hwrD (D:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagdyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst