PDB entry 6hw2

View 6hw2 on RCSB PDB site
Description: The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains
Class: transport protein
Keywords: Complex, transport protein
Deposited on 2018-10-11, released 2020-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-dependent L-type calcium channel subunit beta-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CACNB4
    Database cross-references and differences (RAF-indexed):
    • PDB 6HW2
  • Chain 'B':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hw2b_
  • Chain 'C':
    Compound: Chromobox protein homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hw2c_
  • Heterogens: CA, GOL, BME, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6hw2B (B:)
daadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
eerltwhscpedeaq

    Sequence, based on observed residues (ATOM records): (download) 
    >6hw2B (B:)
aadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafye
erltwhscp

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >6hw2C (C:)
daadkprgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafy
eerltwhscpedeaq

    Sequence, based on observed residues (ATOM records): (download) 
    >6hw2C (C:)
prgfargldperiigatdssgelmflmkwkdsdeadlvlakeanmkcpqiviafyeerlt
whs