PDB entry 6hvn

View 6hvn on RCSB PDB site
Description: cdaa-apo y187a mutant
Deposited on 2018-10-11, released 2019-06-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diadenylate cyclase
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: dacA, cdaA, lmo2120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y5E4 (5-End)
      • expression tag (0-4)
      • engineered mutation (91)
  • Chain 'B':
    Compound: Diadenylate cyclase
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: dacA, cdaA, lmo2120
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Y5E4
      • engineered mutation (91)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hvnA (A:)
    gplgsygsriereqhhliesiekstqymakrrigalisvardtgmddyietgiplnakis
    sqllinifipntplhdgaviikgneiasaasalplsdspflskelgtrhraalgisevtd
    sitivvseetggisltkggelfrdvseeelhkillkelvtvtakkpsifskwkggkse
    

    Sequence, based on observed residues (ATOM records):
    >6hvnA (A:)
    gplgsygsriereqhhliesiekstqymakrrigalisvardtgmddyietgiplnakis
    sqllinifipntplhdgaviikgneiasaasalplsdspflskelgtrhraalgisevtd
    sitivvseetggisltkggelfrdvseeelhkillkelvtvtakkpsifskwkgg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hvnB (B:)
    gplgsygsriereqhhliesiekstqymakrrigalisvardtgmddyietgiplnakis
    sqllinifipntplhdgaviikgneiasaasalplsdspflskelgtrhraalgisevtd
    sitivvseetggisltkggelfrdvseeelhkillkelvtvtakkpsifskwkggkse
    

    Sequence, based on observed residues (ATOM records):
    >6hvnB (B:)
    iereqhhliesiekstqymakrrigalisvardtgmddyietgiplnakissqllinifi
    pntplhdgaviikgneiasaasalplsdspflskelgtrhraalgisevtdsitivvsee
    tggisltkggelfrdvseeelhkillkelvtvakkpsif