PDB entry 6hvi

View 6hvi on RCSB PDB site
Description: human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2
Deposited on 2018-10-11, released 2018-11-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PFKFB3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GV5, POP, F6P, FLC, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hviA (A:)
    mpleltqsrvqkiwvpvdhrpslprscgpkltnsptvivmvglpargktyiskkltryln
    wigvptkvfnvgeyrreavkqyssynffrpdneeamkvrkqcalaalrdvksylakeggq
    iavfdatnttrerrhmilhfakendfkaffiesvcddptvvasnimevkisspdykdcns
    aeamddfmkriscyeasyqpldpdkcdrdlslikvidvgrrflvnrvqdhiqsrivyylm
    nihvqprtiylcrhgenehnlqgriggdsglssrgkkfasalskfveeqnlkdlrvwtsq
    lkstiqtaealrlpyeqwkalneidagvceeltyeeirdtypeeyalreqdkyyyryptg
    esyqdlvqrlepvimelerqenvlvichqavlrcllayfldksaeempylkcplhtvlkl
    tpvaygcrvesiylnvesvcthrersedakkgpnplmrrnsvtplaspeptkkprinsfe
    ehvastsaalpsclppevptqlpgqnmkgsrssadssrkh
    

    Sequence, based on observed residues (ATOM records):
    >6hviA (A:)
    pleltqsrvqkiwvpvhrnsptvivmvglpargktyiskkltrylnwigvptkvfnvgey
    rreavkqyssynffrpdneeamkvrkqcalaalrdvksylakeggqiavfdatnttrerr
    hmilhfakendfkaffiesvcddptvvasnimevkisspdykdcnsaeamddfmkriscy
    easyqpldpdkcdrdlslikvidvgrrflvnrvqdhiqsrivyylmnihvqprtiylcrh
    genehnlqgriggdsglssrgkkfasalskfveeqnlkdlrvwtsqlkstiqtaealrlp
    yeqwkalneidagvceeltyeeirdtypeeyalreqdkyyyryptgesyqdlvqrlepvi
    melerqenvlvichqavlrcllayfldksaeempylkcplhtvlkltpvaygcrvesiyl
    nvesvcthrerse