PDB entry 6hux

View 6hux on RCSB PDB site
Description: hmdii from methanocaldococcus jannaschii reconstitued with fe- guanylylpyridinol (fegp) cofactor and co-crystallized with methenyl- tetrahydromethanopterin at 2.5 a resolution
Deposited on 2018-10-09, released 2019-01-09
The last revision was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(2)-forming methylenetetrahydromethanopterin dehydrogenase-related protein MJ1338
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Gene: MJ1338
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58734 (Start-352)
      • expression tag (353-370)
  • Heterogens: ACT, FE9, NA, E4M, MG, SO4, EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6huxA (A:)
    mrnirkikvdnmkvsvygagnqnlyinklnlpekfggeppyggsrmaiefaeaghdvvla
    epnknimsddlwkkvedagvkvvsddveaakhgeihvlftpfgkatfriaktiiehvpen
    avicntctvspvvlyyslepilrtkrkdvgissmhpaavpgtpqhghyviggkttdgkel
    ateeqikkavelaksagkeayvvpadvssvvadmgslvtavalsgvldyytvgrkiinap
    kkmieqqvimtlqtmaslvetsgiegmvkalnpellirsassmklldrqkdldaaleilq
    nldetlkaevekaeikpttlvaaqslvkeiktliggaaaegaikrsarklfehadpnsss
    vdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6huxA (A:)
    nirkikvdnmkvsvygagnqnlyinklnlpekfggeppyggsrmaiefaeaghdvvlaep
    nknimsddlwkkvedagvkvvsddveaakhgeihvlftpfgkatfriaktiiehvpenav
    icntctvspvvlyyslepilrtkrkdvgissmhpaavpgtpqhghyviggkttdgkelat
    eeqikkavelaksagkeayvvpadvssvvadmgslvtavalsgvldyytvgrkiinapkk
    mieqqvimtlqtmaslvetsgiegmvkalnpellirsassmklldrqkdldaaleilqnl
    detlkaevekaeikpttlvaaqslvkeiktliggaaaegaikrsarklfehadpnsssvd
    klaaalehh