PDB entry 6hul

View 6hul on RCSB PDB site
Description: Sulfolobus solfataricus Tryptophan Synthase AB Complex
Class: lyase
Keywords: Tryptophan Synthase PLP, lyase
Deposited on 2018-10-08, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tryptophan synthase alpha chain
  Species: Sulfolobus solfataricus [TaxId:2287]
  Gene: trpA, SSO0889
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50382 (0-240)
  Domains in SCOPe 2.08: d6hula_
• Chain 'B':
  Compound: Tryptophan synthase beta chain 1
  Species: Sulfolobus solfataricus [TaxId:2287]
  Gene: trpB1, trpB, SSO0888
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50383
• Heterogens: G3P, SER, PLP, SO4, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6hulA (A:)
  gkmlvvymtlgypnvqsfkdfiigavengadilelgippkyakydgpvirksydkvkgld
  iwpliedirkdvgvpiialtyledwvdqlenflnmikdvkldgilfpdllidyiddldki
  dgiiknkglknviftspsvpdllihkvskisdlflyygvrpttgvpipvsvkqlinrvrn
  lvenklivgfglssesdlrdalsagadgiaigtvfieeierngvksainlvkkfrailde
  y
  

  
  
• Chain 'B':
  No sequence available.