PDB entry 6hui

View 6hui on RCSB PDB site
Description: The structure of Dps from Listeria innocua soaked with zinc
Class: metal binding protein
Keywords: Dps, metal binding. cage shaped protein, ferroxidase, itron translocation, METAL BINDING PROTEIN
Deposited on 2018-10-08, released 2019-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huia_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huib_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huic_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huid_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huie_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Listeria innocua [TaxId:1642]
    Gene: dps, flp, fri, lin0942
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6huif_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6huiA (A:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiA (A:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6huiB (B:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiB (B:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6huiC (C:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiC (C:)
    dtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6huiD (D:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiD (D:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6huiE (E:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiE (E:)
    nsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerl
    laiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkeg
    ddvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6huiF (F:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huiF (F:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple