PDB entry 6huh

View 6huh on RCSB PDB site
Description: CRYSTAL STRUCTURE OF OXA-427 class D BETA-LACTAMASE
Class: hydrolase
Keywords: CLASS D BETA-LACTAMASE OXA-427-HisTag, ANTIBIOTIC, DIMER, HYDROLASE
Deposited on 2018-10-08, released 2019-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA-427, PKLPN57_278
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y6M6D7 (Start-263)
      • expression tag (264)
    Domains in SCOPe 2.08: d6huha1, d6huha2
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA-427, PKLPN57_278
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y6M6D7 (Start-263)
      • expression tag (264)
    Domains in SCOPe 2.08: d6huhb1, d6huhb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6huhA (A:)
    msrillssllaaglfcslpasaatgcmlfadgsgkpfsaqgdcasqlppastfkiplalm
    gydsgflvdeqlpalpfkagdpdflpewkqtttpsrwmtysviwysqrltewlgaarfqq
    yvdrfdygnrdlsgnpgkhdgltqawlssslaispqeqarflgklvsgklpvsaqtlqht
    anilrqpdidgwqihgktgtgypklldgsldrdqqigwfvgwaskqdqklifvhtviqkp
    gkqfaslrareevfaalpeqlkklvehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huhA (A:)
    tgcmlfadgsgkpfsaqgdcasqlppastfkiplalmgydsgflvdeqlpalpfkagdpd
    flpewkqtttpsrwmtysviwysqrltewlgaarfqqyvdrfdygnrdlsgnpgkhdglt
    qawlssslaispqeqarflgklvsgklpvsaqtlqhtanilrqpdidgwqihgktgtgyp
    klldgsldrdqqigwfvgwaskqdqklifvhtviqkpgkqfaslrareevfaalpeqlkk
    lv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6huhB (B:)
    msrillssllaaglfcslpasaatgcmlfadgsgkpfsaqgdcasqlppastfkiplalm
    gydsgflvdeqlpalpfkagdpdflpewkqtttpsrwmtysviwysqrltewlgaarfqq
    yvdrfdygnrdlsgnpgkhdgltqawlssslaispqeqarflgklvsgklpvsaqtlqht
    anilrqpdidgwqihgktgtgypklldgsldrdqqigwfvgwaskqdqklifvhtviqkp
    gkqfaslrareevfaalpeqlkklvehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6huhB (B:)
    tgcmlfadgsgkpfsaqgdcasqlppastfkiplalmgydsgflvdeqlpalpfkagdpd
    flpewkqtttpsrwmtysviwysqrltewlgaarfqqyvdrfdygnrdlsgnpgkhdglt
    qawlssslaispqeqarflgklvsgklpvsaqtlqhtanilrqpdidgwqihgktgtgyp
    klldgsldrdqqigwfvgwaskqdqklifvhtviqkpgkqfaslrareevfaalpeqlkk
    lv