PDB entry 6htk

View 6htk on RCSB PDB site
Description: x-ray structure of the tryptophan lyase nosl in complex with (r)-(+)- indoline-2-carboxylate
Deposited on 2018-10-04, released 2018-11-21
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyl-2-indolic acid synthase
    Species: Streptomyces actuosus [TaxId:1885]
    Gene: nosL, nocL, DMT42_23170
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3-methyl-2-indolic acid synthase
    Species: Streptomyces actuosus [TaxId:1885]
    Gene: nosL, nocL, DMT42_23170
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, GOL, BR, NA, SAH, MET, 5AD, ICB, K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6htkA (A:)
    mtqnsqamtshamtgdfvlpeledvraeaatvdtravlalaegeepaesraavalalwed
    rsigtaelqaaaearcgarrprlhtfvplyttnycdseckmcsmrkgnhrldrkfsgrke
    iteqleilyhhegvrgvgfltgeyedkhtrlasafrigwairtaldlgfervyfnigsme
    qdeidvlgewigredpvtmcvfqesydretyrrfmgktsvgvpkadfdrrvvsfdrwlda
    gyryvnpgvlvglhddlsaelvslvahgdhlrsrgatadlsvprmrpamksrdttrvgdd
    dylrlmsvvaftcpeqrlvlttrepqefqdvalglagvispgspdvapyragcearndek
    ssqflvadlrrprhilgrieasgtpvdhfvnpageasrav
    

    Sequence, based on observed residues (ATOM records):
    >6htkA (A:)
    gdfvlpeledvraeaatvdtravlalaegeepaesraavalalwedrsigtaelqaaaea
    rcgarrprlhtfvplyttnycdseckmcsmrkgnhrldrkfsgrkeiteqleilyhhegv
    rgvgfltgeyedkhtrlasafrigwairtaldlgfervyfnigsmeqdeidvlgewigre
    dpvtmcvfqesydretyrrfmgktsvgvpkadfdrrvvsfdrwldagyryvnpgvlvglh
    ddlsaelvslvahgdhlrsrgatadlsvprmrpamksrdttrvgdddylrlmsvvaftcp
    eqrlvlttrepqefqdvalglagvispgspdvapyragcearndekssqflvadlrrprh
    ilgrieasgtpvdhfvnpageasr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6htkB (B:)
    mtqnsqamtshamtgdfvlpeledvraeaatvdtravlalaegeepaesraavalalwed
    rsigtaelqaaaearcgarrprlhtfvplyttnycdseckmcsmrkgnhrldrkfsgrke
    iteqleilyhhegvrgvgfltgeyedkhtrlasafrigwairtaldlgfervyfnigsme
    qdeidvlgewigredpvtmcvfqesydretyrrfmgktsvgvpkadfdrrvvsfdrwlda
    gyryvnpgvlvglhddlsaelvslvahgdhlrsrgatadlsvprmrpamksrdttrvgdd
    dylrlmsvvaftcpeqrlvlttrepqefqdvalglagvispgspdvapyragcearndek
    ssqflvadlrrprhilgrieasgtpvdhfvnpageasrav
    

    Sequence, based on observed residues (ATOM records):
    >6htkB (B:)
    mtgdfvlpeledvraeaatvdtravlalaegeepaesraavalalwedrsigtaelqaaa
    earcgarrprlhtfvplyttnycdseckmcsmrkgnhrldrkfsgrkeiteqleilyhhe
    gvrgvgfltgeyedkhtrlasafrigwairtaldlgfervyfnigsmeqdeidvlgewig
    redpvtmcvfqesydretyrrfmgktsvgvpkadfdrrvvsfdrwldagyryvnpgvlvg
    lhddlsaelvslvahgdhlrsrgatadlsvprmrpamksrdttrvgdddylrlmsvvaft
    cpeqrlvlttrepqefqdvalglagvispgspdvapyragcearndekssqflvadlrrp
    rhilgrieasgtpvdhfvnpa