PDB entry 6htj

View 6htj on RCSB PDB site
Description: crystal structure of the translation recovery factor trf from sulfolobus solfataricus
Deposited on 2018-10-04, released 2019-10-16
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleic-acid-binding protein containing a Zn-ribbon
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSOP1_2634, SULA_0310, SULB_0312, SULC_0310
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nucleic-acid-binding protein containing a Zn-ribbon
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: SSOP1_2634, SULA_0310, SULB_0312, SULC_0310
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6htjA (A:)
mreeeirelyfkyfdenklpfiqcnkcghkfyyprvlcpkcgssdievrfskglgkifam
tkvyrkdgsyviygiveleegfrmysniieesqadinrkvevifkeingkkyplfktvt

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6htjB (B:)
mreeeirelyfkyfdenklpfiqcnkcghkfyyprvlcpkcgssdievrfskglgkifam
tkvyrkdgsyviygiveleegfrmysniieesqadinrkvevifkeingkkyplfktvt

    Sequence, based on observed residues (ATOM records):
    >6htjB (B:)
reeeirelyfkyfdenklpfiqcnkcghkfyyprvlcpkcgssdievrfskglgkifamt
kvyrkdgsyviygiveleegfrmysniieesqadinrkvevifkeingkkyplfktvt