PDB entry 6ht1

View 6ht1 on RCSB PDB site
Description: crystal structure of mllt1 (enl) yeats domain in complexed with sgc- imllt (compound 92)
Deposited on 2018-10-02, released 2018-10-17
The last revision was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ENL
    Species: Homo sapiens [TaxId:9606]
    Gene: MLLT1, ENL, LTG19, YEATS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, GQ5, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ht1A (A:)
smdnqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsf
pkprrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrc
ekltfnnpttefrykllraggvmvmpegahhhhhh

    Sequence, based on observed residues (ATOM records):
    >6ht1A (A:)
dnqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsfpk
prrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrcek
ltfnnpttefrykllraggvmvm