PDB entry 6hsq

View 6hsq on RCSB PDB site
Description: the crystal structure of type ii dehydroquinase from psychromonas ingrahamii 37 crystal form 1
Deposited on 2018-10-01, released 2019-10-23
The last revision was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Psychromonas ingrahamii (strain 37) [TaxId:357804]
    Gene: aroQ, Ping_3121
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Psychromonas ingrahamii (strain 37) [TaxId:357804]
    Gene: aroQ, Ping_3121
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1SZA3 (3-151)
      • expression tag (1-2)
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Psychromonas ingrahamii (strain 37) [TaxId:357804]
    Gene: aroQ, Ping_3121
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Psychromonas ingrahamii (strain 37) [TaxId:357804]
    Gene: aroQ, Ping_3121
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1SZA3 (3-151)
      • expression tag (0-2)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hsqA (A:)
    gshmtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnre
    yeliekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhs
    ylsdiaqgvicglgakgysfalqsaigklrni
    

    Sequence, based on observed residues (ATOM records):
    >6hsqA (A:)
    tqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnreyeli
    ekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhsylsd
    iaqgvicglgakgysfalqsaigklrni
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hsqB (B:)
    gshmtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnre
    yeliekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhs
    ylsdiaqgvicglgakgysfalqsaigklrni
    

    Sequence, based on observed residues (ATOM records):
    >6hsqB (B:)
    shmtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnrey
    eliekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhsy
    lsdiaqgvicglgakgysfalqsaigklrni
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hsqC (C:)
    gshmtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnre
    yeliekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhs
    ylsdiaqgvicglgakgysfalqsaigklrni
    

    Sequence, based on observed residues (ATOM records):
    >6hsqC (C:)
    mtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnreyel
    iekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhsyls
    diaqgvicglgakgysfalqsaigklrni
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6hsqD (D:)
    gshmtqqikllvlngpnlnllgqrepevygsktlddiikaltdeaalqnvalshlqsnre
    yeliekihdafekidfiiinpaafthtsvalrdallgvnipfievhlsnvharesfrhhs
    ylsdiaqgvicglgakgysfalqsaigklrni