PDB entry 6hsj

View 6hsj on RCSB PDB site
Description: crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) in complex with coa
Deposited on 2018-10-01, released 2019-01-02
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SCP2-thiolase (type-1)
    Species: Danio rerio [TaxId:7955]
    Gene: scp2a, scp2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SCP2-thiolase (type-1)
    Species: Danio rerio [TaxId:7955]
    Gene: scp2a, scp2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, GOL, COA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hsjA (A:)
    mhhhhhhamaalrnrvfvigvgmtkfekpgardidypdmakeagqraladagikysaiqq
    acvgyvygdstcgqraiyhslglsgipiinvnnncstgstalfmgrqliqggladcvlal
    gfekmergslsskymdrtnpmdkhmevminryglaavpaapqmfgnagrehmekygtkpe
    hfakvawknhkhstnnpysqfqdeysleqvidsrkvfefltllqccptsdgagaavlase
    sfvrrnglekkaveivaqemvtdlsttfeenscmkmvgydmtrlaaercydtagvkpsdv
    dvielhdcfsanelityealglcpegkagelidrgdntyggkwvinpsggliskghplga
    tglaqcaelcwqlraeagprqvpgaklalqhniglggavvvtlykmgfpqetss
    

    Sequence, based on observed residues (ATOM records):
    >6hsjA (A:)
    nrvfvigvgmtkfekpgardidypdmakeagqraladagikysaiqqacvgyvygdstcg
    qraiyhslglsgipiinvnnncstgstalfmgrqliqggladcvlalgfekmenpmdkhm
    evminryglaavpaapqmfgnagrehmekygtkpehfakvawknhkhstnnpysqfqdey
    sleqvidsrkvfefltllqccptsdgagaavlasesfvrrnglekkaveivaqemvtdls
    ttfeenscmkmvgydmtrlaaercydtagvkpsdvdvielhdcfsanelityealglcpe
    gkagelidrgdntyggkwvinpsggliskghplgatglaqcaelcwqlraeagprqvpga
    klalqhniglggavvvtlykmgfp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hsjB (B:)
    mhhhhhhamaalrnrvfvigvgmtkfekpgardidypdmakeagqraladagikysaiqq
    acvgyvygdstcgqraiyhslglsgipiinvnnncstgstalfmgrqliqggladcvlal
    gfekmergslsskymdrtnpmdkhmevminryglaavpaapqmfgnagrehmekygtkpe
    hfakvawknhkhstnnpysqfqdeysleqvidsrkvfefltllqccptsdgagaavlase
    sfvrrnglekkaveivaqemvtdlsttfeenscmkmvgydmtrlaaercydtagvkpsdv
    dvielhdcfsanelityealglcpegkagelidrgdntyggkwvinpsggliskghplga
    tglaqcaelcwqlraeagprqvpgaklalqhniglggavvvtlykmgfpqetss
    

    Sequence, based on observed residues (ATOM records):
    >6hsjB (B:)
    nrvfvigvgmtkfekpgardidypdmakeagqraladagikysaiqqacvgyvygdstcg
    qraiyhslglsgipiinvnnncstgstalfmgrqliqggladcvlalgfekmekymdrtn
    pmdkhmevminryglaavpaapqmfgnagrehmekygtkpehfakvawknhkhstnnpys
    qfqdeysleqvidsrkvfefltllqccptsdgagaavlasesfvrrnglekkaveivaqe
    mvtdlsttfeenscmkmvgydmtrlaaercydtagvkpsdvdvielhdcfsanelityea
    lglcpegkagelidrgdntyggkwvinpsggliskghplgatglaqcaelcwqlraeagp
    rqvpgaklalqhniglggavvvtlykmgfp