PDB entry 6hsf

View 6hsf on RCSB PDB site
Description: crystal structure of schistosoma mansoni hdac8 mutant h292m complexed with pci-34051
Deposited on 2018-10-01, released 2018-10-31
The last revision was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: HDAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5H660
      • engineered mutation (292)
  • Chain 'B':
    Compound: Histone deacetylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: HDAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5H660 (Start-440)
      • engineered mutation (292)
      • expression tag (441-446)
  • Chain 'C':
    Compound: Histone deacetylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: HDAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5H660 (Start-440)
      • engineered mutation (292)
      • expression tag (441-446)
  • Chain 'D':
    Compound: Histone deacetylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: HDAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5H660
      • engineered mutation (292)
  • Heterogens: ZN, K, GKW, DMF, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hsfA (A:)
    hmsvgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeav
    tafhsteyvdalkklqmlhceekeltaddellmdsfslnydcpgfpsvfdyslaavqgsl
    aaasalicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstppetspnrqtr
    vlyvdldlhhgdgveeafwysprvvtfsvhhaspgffpgtgtwnmvdndklpiflngagr
    grfsafnlpleegindldwsnaigpildslniviqpsyvvvqcgadclatdpmrifrltn
    fypnlnldsdcdsecslsgylyaikkilswkvptlilggggynfpdtarlwtrvtaltie
    evkgkkmtispeipehsyfsrygpdfeldidyfpheshnktldsiqkhhrrileqlrnya
    dlnkliydydqvyqlynltgmgslvpr
    

    Sequence, based on observed residues (ATOM records):
    >6hsfA (A:)
    svgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeavta
    fhsteyvdalkklqmlhceeltaddellmdsfslnydcpgfpsvfdyslaavqgslaaas
    alicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstqtrvlyvdldlhhgd
    gveeafwysprvvtfsvhhaspgffpgtgtwnpiflngagrgrfsafnlpleegindldw
    snaigpildslniviqpsyvvvqcgadclatdpmrifrltnfyplsgylyaikkilswkv
    ptlilggggynfpdtarlwtrvtaltieevkgkkmtispeipehsyfsrygpdfeldidy
    fpdsiqkhhrrileqlrnyadlnkliydydqvyqly
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hsfB (B:)
    hmsvgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeav
    tafhsteyvdalkklqmlhceekeltaddellmdsfslnydcpgfpsvfdyslaavqgsl
    aaasalicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstppetspnrqtr
    vlyvdldlhhgdgveeafwysprvvtfsvhhaspgffpgtgtwnmvdndklpiflngagr
    grfsafnlpleegindldwsnaigpildslniviqpsyvvvqcgadclatdpmrifrltn
    fypnlnldsdcdsecslsgylyaikkilswkvptlilggggynfpdtarlwtrvtaltie
    evkgkkmtispeipehsyfsrygpdfeldidyfpheshnktldsiqkhhrrileqlrnya
    dlnkliydydqvyqlynltgmgslvpr
    

    Sequence, based on observed residues (ATOM records):
    >6hsfB (B:)
    svgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeavta
    fhsteyvdalkklqmlhceltaddellmdsfslnydcpgfpsvfdyslaavqgslaaasa
    licrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstqtrvlyvdldlhhgdg
    veeafwysprvvtfsvhhaspgffpgtgtwiflngagrgrfsafnlpleegindldwsna
    igpildslniviqpsyvvvqcgadclatdpmrifrltnfyplsgylyaikkilswkvptl
    ilggggynfpdtarlwtrvtaltieevkgkkmtispeipehsyfsrygpdfeldidyfph
    dsiqkhhrrileqlrnyadlnkliydydqvyqlynltgmgslvpr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hsfC (C:)
    hmsvgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeav
    tafhsteyvdalkklqmlhceekeltaddellmdsfslnydcpgfpsvfdyslaavqgsl
    aaasalicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstppetspnrqtr
    vlyvdldlhhgdgveeafwysprvvtfsvhhaspgffpgtgtwnmvdndklpiflngagr
    grfsafnlpleegindldwsnaigpildslniviqpsyvvvqcgadclatdpmrifrltn
    fypnlnldsdcdsecslsgylyaikkilswkvptlilggggynfpdtarlwtrvtaltie
    evkgkkmtispeipehsyfsrygpdfeldidyfpheshnktldsiqkhhrrileqlrnya
    dlnkliydydqvyqlynltgmgslvpr
    

    Sequence, based on observed residues (ATOM records):
    >6hsfC (C:)
    svgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeavta
    fhsteyvdalkklqmlhceltaddellmdsfslnydcpgfpsvfdyslaavqgslaaasa
    licrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstqtrvlyvdldlhhgdg
    veeafwysprvvtfsvhhaspgffpgtgtwiflngagrgrfsafnlpleegindldwsna
    igpildslniviqpsyvvvqcgadclatdpmrifrltnfypslsgylyaikkilswkvpt
    lilggggynfpdtarlwtrvtaltieevkgkkmtispeipehsyfsrygpdfeldidyfp
    hdsiqkhhrrileqlrnyadlnkliydydqvyqlynltgmgslvpr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6hsfD (D:)
    hmsvgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeav
    tafhsteyvdalkklqmlhceekeltaddellmdsfslnydcpgfpsvfdyslaavqgsl
    aaasalicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstppetspnrqtr
    vlyvdldlhhgdgveeafwysprvvtfsvhhaspgffpgtgtwnmvdndklpiflngagr
    grfsafnlpleegindldwsnaigpildslniviqpsyvvvqcgadclatdpmrifrltn
    fypnlnldsdcdsecslsgylyaikkilswkvptlilggggynfpdtarlwtrvtaltie
    evkgkkmtispeipehsyfsrygpdfeldidyfpheshnktldsiqkhhrrileqlrnya
    dlnkliydydqvyqlynltgmgslvpr
    

    Sequence, based on observed residues (ATOM records):
    >6hsfD (D:)
    svgivygdqyrqlccsspkfgdryalvmdlinayklipelsrvpplqwdspsrmyeavta
    fhsteyvdalkklqmlhceekeltaddellmdsfslnydcpgfpsvfdyslaavqgslaa
    asalicrhcevvinwgggwhhakrseasgfcylndivlaihrlvsstrvlyvdldlhhgd
    gveeafwysprvvtfsvhhaspgffpgtgtwnlpiflngagrgrfsafnlpleegindld
    wsnaigpildslniviqpsyvvvqcgadclatdpmrifrltnfypslsgylyaikkilsw
    kvptlilggggynfpdtarlwtrvtaltieevkgkkmtispeipehsyfsrygpdfeldi
    dyfpdsiqkhhrrileqlrnyadlnkliydydqvyq