PDB entry 6hsb

View 6hsb on RCSB PDB site
Description: The crystal structure of type II Dehydroquinase from Acidithiobacillus caldus SM-1
Class: biosynthetic protein
Keywords: shikimate pathway, dehydratase, BIOSYNTHETIC PROTEIN
Deposited on 2018-09-29, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Acidithiobacillus caldus (strain SM-1) [TaxId:990288]
    Gene: aroQ, Atc_2874
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hsba_
  • Heterogens: GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hsbA (A:)
    aqihvlvlhgpnlnllgrrepdhygrttlaeidarlkteaegrgwllhslqsnaehilvd
    avqqaptqgvthivlnpaafthtsvalrdalaavaipfievhlsniharepfrrhsyfsd
    iasglitglgaegyslaldaiarrf