PDB entry 6hs8

View 6hs8 on RCSB PDB site
Description: The crystal structure of type II Dehydroquinase from Butyrivibrio crossotus DSM 2876
Class: biosynthetic protein
Keywords: shikimate pathway, dehydratase, BIOSYNTHETIC PROTEIN
Deposited on 2018-09-29, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Butyrivibrio crossotus DSM 2876 [TaxId:511680]
    Gene: aroQ, BUTYVIB_01550
    Database cross-references and differences (RAF-indexed):
    • Uniprot D4S0D1 (2-143)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6hs8a1, d6hs8a2
  • Heterogens: TLA, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hs8A (A:)
    shmkilvingpnlnflgirekniygnenyeylvnmineycksknievecyqsnhegaiid
    kiqeayfngtdgivinpgaythysyairdalasvshikkievhisnvnereefrhisvte
    pvcngqivgqglkgyimaidmlns