PDB entry 6hrj

View 6hrj on RCSB PDB site
Description: apo - yndl
Deposited on 2018-09-27, released 2018-10-10
The last revision was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YndL
    Species: Bacillus subtilis [TaxId:1423]
    Gene: B4417_0239
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A164XNU3 (Start-205)
      • expression tag (206)
  • Heterogens: SO4, 010, FAH, FLC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hrjA (A:)
    ssiyaedvyqnfeelknnedpsdygvvtketgspvlvlaihgggieggtsevarelskey
    smylfeglksagnsvlhitsthfdepralkmtgnheyvislhgyaeedqqievggtdrvr
    aadlveklqhagfpavllnmdhphagvspnnianksktglsiqiemstgfrkslfgifsl
    ksravtqnerfyeftevmfrflknsylehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hrjA (A:)
    edvyqnfeelknnedpsdygvvtketgspvlvlaihgggieggtsevarelskeysmylf
    eglksagnsvlhitsthfdepralkmtgnheyvislhgyaeedqqievggtdrvraadlv
    eklqhagfpavllnmdhphagvspnnianksktglsiqiemstgfrkslfgifslksrav
    tqnerfyeftevmfrflknsyl