PDB entry 6hr7

View 6hr7 on RCSB PDB site
Description: hmg-coa reductase from methanothermococcus thermolithotrophicus apo form at 2.4 a resolution
Deposited on 2018-09-26, released 2019-02-13
The last revision was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hmg-coa reductase
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Gene: HMGR
    Database cross-references and differences (RAF-indexed):
    • PDB 6HR7
  • Chain 'B':
    Compound: hmg-coa reductase
    Species: Methanothermococcus thermolithotrophicus DSM 2095 [TaxId:523845]
    Gene: HMGR
    Database cross-references and differences (RAF-indexed):
    • PDB 6HR7
  • Heterogens: SO4, DTT, NA, GOL, P6G, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hr7A (A:)
    mgsshhhhhhssglvprgshmmekgnneilekllkkeikpyqlddlvgekeaielrrkyi
    ekisqvetkhighytidekeamkknienmigavqiplgfagplkingkyangefyvplat
    tegalvasvnrgcsivtkcggvtvrviddkmtrapviktesvidavklkewikenfqrik
    evaesttrhgklidinpilivgryvyprfvyktgdamgmnmvtiatekacnfieeelkke
    ninihtvalsgnacvdkkpaginliegrgksiiaevflkeeeikkylkttskaieqvnmy
    knligsaisnsmgfnahyaniigalflatgqdeahivegslgitvaectedgvyfsvtlp
    dvpvgtvgggtrvetqkeclellgchggdkalkfaeivgatvlagelsligalsvghlar
    ahaqlgr
    

    Sequence, based on observed residues (ATOM records):
    >6hr7A (A:)
    neilekllkkeikpyqlddlvgekeaielrrkyiekisqvetkhighytidekeamkkni
    enmigavqiplgfagplkingkyangefyvplattegalvasvnrgcsivtkcggvtvrv
    iddkmtrapviktesvidavklkewikenfqrikevaesttrhgklidinpilivgryvy
    prfvyktgdamgmnmvtiatekacnfieeelkkeninihtvalsgnacvdkkpaginlie
    grgksiiaevflkeeeikkylkttskaieqvnmyknligsaisnsmgfnahyaniigalf
    latgqdeahivegslgitvaectedgvyfsvtlpdvpvgtvgggtrvetqkeclellgch
    ggdkalkfaeivgatvlagelsligalsvghlarah
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hr7B (B:)
    mgsshhhhhhssglvprgshmmekgnneilekllkkeikpyqlddlvgekeaielrrkyi
    ekisqvetkhighytidekeamkknienmigavqiplgfagplkingkyangefyvplat
    tegalvasvnrgcsivtkcggvtvrviddkmtrapviktesvidavklkewikenfqrik
    evaesttrhgklidinpilivgryvyprfvyktgdamgmnmvtiatekacnfieeelkke
    ninihtvalsgnacvdkkpaginliegrgksiiaevflkeeeikkylkttskaieqvnmy
    knligsaisnsmgfnahyaniigalflatgqdeahivegslgitvaectedgvyfsvtlp
    dvpvgtvgggtrvetqkeclellgchggdkalkfaeivgatvlagelsligalsvghlar
    ahaqlgr
    

    Sequence, based on observed residues (ATOM records):
    >6hr7B (B:)
    neilekllkkeikpyqlddlvgekeaielrrkyiekisqvetkhighytidekeamkkni
    enmigavqiplgfagplkingkyangefyvplattegalvasvnrgcsivtkcggvtvrv
    iddkmtrapviktesvidavklkewikenfqrikevaesttrhgklidinpilivgryvy
    prfvyktgdamgmnmvtiatekacnfieeelkkeninihtvalsgnacvdkkpaginlie
    grgksiiaevflkeeeikkylkttskaieqvnmyknligsaisnsmgfnahyaniigalf
    latgqdeahivegslgitvaectedgvyfsvtlpdvpvgtvgggtrvetqkeclellgch
    ggdkalkfaeivgatvlagelsligalsvghlara