PDB entry 6hr2

View 6hr2 on RCSB PDB site
Description: Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and pVHL:ElonginC:ElonginB
Class: transcription
Keywords: bromodomain, BRG1, SMARCA4, PROTAC, VHL, ternary complex, transcription
Deposited on 2018-09-26, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.7600000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription activator BRG1
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA4, BAF190A, BRG1, SNF2B, SNF2L4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2a_
  • Chain 'B':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2b_
  • Chain 'C':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d6hr2c1, d6hr2c2
  • Chain 'D':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2d_
  • Chain 'E':
    Compound: Transcription activator BRG1
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA4, BAF190A, BRG1, SNF2B, SNF2L4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2e_
  • Chain 'F':
    Compound: von hippel-lindau disease tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Gene: VHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2f_
  • Chain 'G':
    Compound: Elongin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOC, TCEB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15369 (1-96)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d6hr2g1, d6hr2g2
  • Chain 'H':
    Compound: Elongin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: ELOB, TCEB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hr2h_
  • Heterogens: FWZ, DMS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hr2A (A:)
    eklspnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfk
    kikerirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hr2A (A:)
    spnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfkkik
    erirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hr2B (B:)
    pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
    dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
    vrslyedledhpnvqkdlerltqeriahq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hr2C (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hr2C (C:)
    mmyvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hr2D (D:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hr2E (E:)
    eklspnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfk
    kikerirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hr2F (F:)
    pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
    dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
    vrslyedledhpnvqkdlerltqeriahq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hr2G (G:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hr2G (G:)
    mmyvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytn
    ssteipefpiapeialellmaanfldc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hr2H (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hr2H (H:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvm