PDB entry 6hqz

View 6hqz on RCSB PDB site
Description: crystal structure of the type iii effector protein avrrpt2 from erwinia amylovora, a c70 family cysteine protease
Deposited on 2018-09-25, released 2019-04-10
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AvrRpt2
    Species: Erwinia amylovora [TaxId:552]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: AvrRpt2
    Species: Erwinia amylovora [TaxId:552]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hqzA (A:)
ngfrlnhvpyvsqqnermgcwyactrmlghsissgprlglpelydssgpqglqqredvlr
lmrnenlaevslpesrqfsanelgnllcrhgpimfgwqtpagswhmsvltgidkpndaii
fhdpqrgpdltmpldsfnqrlawrvphamlysen

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6hqzB (B:)
ngfrlnhvpyvsqqnermgcwyactrmlghsissgprlglpelydssgpqglqqredvlr
lmrnenlaevslpesrqfsanelgnllcrhgpimfgwqtpagswhmsvltgidkpndaii
fhdpqrgpdltmpldsfnqrlawrvphamlysen