PDB entry 6hqw

View 6hqw on RCSB PDB site
Description: Cytochrome P450-153 from Novosphingobium aromaticivorans
Class: oxidoreductase
Keywords: cytochrome P450, heme, biocatalysis, Cyp153 family, METAL BINDING PROTEIN, oxidoreductase
Deposited on 2018-09-25, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Gene: Saro_0220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hqwa_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:48935]
    Gene: Saro_0220
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hqwA (A:)
    matqlapevpqftyhssptateafaawlkdnpqaipahshpwdvsrsdiyvedrwqpifa
    emrakapvnrvpdspygaywnvashkaimhveslpelfssswqyggitigdppedvdpqk
    laerqlpmfiamdrpdhtgqrrtvapaftpakmvemeaeirrrtasvldslpwgerfdwv
    dkvsielttgmlailfgfpwadrrlltfwsdwagdveltlareladtrfgflgemahyfq
    rlwgarmqappsgdlismmihseamnhmspqefmgnlvllivggndttrntmsgivhald
    kfpdqrellerdaslipnavqeciryvtplahmrrtatadtelfgnqikagekvilwyis
    anrdetvfenpdklmvdrpnarrhlsfghgihrcvgarlaelqlrilleemherrmrvrv
    agevervranfvhgfrklevelekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hqwA (A:)
    shpwdvsrsdiyvedrwqpifaemrakapvnrvpdspygaywnvashkaimhveslpelf
    ssswqyggitigdppedvdpqklaerqlpmfiamdrpdhtgqrrtvapaftpakmvemea
    eirrrtasvldslpwgerfdwvdkvsielttgmlailfgfpwrlltfwsdwagltlarel
    adtrfgflgemahyfqrlwgarmqgdlismmihseamnhmspqefmgnlvllivggndtt
    rntmsgivhaldkfpdqrellerdaslipnavqeciryvtplahmrrtatadtelfgnqi
    kagekvilwyisanrdetvfenpdklmvdrpnarrhlsfghgihrcvgarlaelqlrill
    eemherrmrvrvagevervranfvhgfrklevele
    

  • Chain 'B':
    No sequence available.