PDB entry 6hqc

View 6hqc on RCSB PDB site
Description: structural investigation of the tasa anchoring protein tapa from bacillus subtilis
Deposited on 2018-09-24, released 2019-10-09
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TasA anchoring/assembly protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tapA, yqhD, yqxM, BSU24640
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hqcA (A:)
dqsdlhisdqtdtkgtvcspfalfavlentgeklkkskwkwelhklenarkplkdgnvie
kgfvsnqigdslykietkkkmkpgiyafkvykpagypangstfewsepmrlakcde