PDB entry 6hq2

View 6hq2 on RCSB PDB site
Description: structure of eal enzyme bd1971 - apo form
Deposited on 2018-09-24, released 2019-07-31
The last revision was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EAL Enzyme Bd1971
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd1971
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: EAL Enzyme Bd1971
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd1971
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hq2A (A:)
aaqsvdihkdqiifsegdagdcayiiekgrvliyltkdkeeipltilgegeifgemalid
nqnrsasvraledvrlaivtkqqvlervstadkvvqllmrvllkrlrr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hq2B (B:)
aaqsvdihkdqiifsegdagdcayiiekgrvliyltkdkeeipltilgegeifgemalid
nqnrsasvraledvrlaivtkqqvlervstadkvvqllmrvllkrlrr

    Sequence, based on observed residues (ATOM records):
    >6hq2B (B:)
aaqsvdihkdqiifsegdagdcayiiekgrvliyltkdkeeipltilgegeifgemalid
nqnrsasvraledvrlaivtkqqvlervstadkvvqllmrvllkrlr