PDB entry 6hpy

View 6hpy on RCSB PDB site
Description: crystal structure of enl (mllt1) in complex with compound 12
Deposited on 2018-09-22, released 2018-11-28
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ENL
    Species: Homo sapiens [TaxId:9606]
    Gene: MLLT1, ENL, LTG19, YEATS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, SO4, GKN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hpyA (A:)
    smdnqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsf
    pkprrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrc
    ekltfnnpttefrykllraggvmvmpegahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hpyA (A:)
    nqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsfpkp
    rrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrcekl
    tfnnpttefrykllraggvmv