PDB entry 6hps

View 6hps on RCSB PDB site
Description: Near-infrared dual bioluminescence imaging in vivo using infra-luciferin
Class: fluorescent protein
Keywords: near-infrared Bioluminescence imaging, P. pyralis luciferase, ANL SUPERFAMILY, LIGASE, ADENYLATING ENZYMES, LUCIFERASE, DOMAIN ALTERNATION, FLUORESCENT PROTEIN
Deposited on 2018-09-21, released 2019-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Luciferin 4-monooxygenase
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpsa_
  • Chain 'B':
    Compound: Luciferin 4-monooxygenase
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpsb_
  • Heterogens: GKH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hpsA (A:)
    aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
    aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
    tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
    esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpf
    hhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
    ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
    kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
    aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
    vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
    kgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpsA (A:)
    knikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrla
    eamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqpt
    vvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvpe
    sfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpfh
    hgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidky
    dlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgk
    vvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdia
    ywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaav
    vvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hpsB (B:)
    aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
    aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
    tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
    esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvvpf
    hhgfgmfttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
    ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
    kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
    aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
    vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
    kgg