PDB entry 6hpo

View 6hpo on RCSB PDB site
Description: Crystallographic structure of the catalytic domain of Human Phenylalanine Hydroxylase (hPAH CD) in complex with iron at 1.6 Angstrom
Class: oxidoreductase
Keywords: Tetrahydrobiopterin, amino acid hydroxylases, phenylketonuria, allosteric regulation, METAL BINDING PROTEIN, oxidoreductase
Deposited on 2018-09-21, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine-4-hydroxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: PAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpoa_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hpoA (A:)
    mstavlenpglgrklsdfgqetsyiedncnqngaislifslkeevgalakvlrlfeendv
    nlthiesrpsrlkkdeyeffthldkrslpaltniikilrhdigatvhelsrdkkkdtvpw
    fprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprveym
    eeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtctgf
    rlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdrsfa
    qfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyclse
    kpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpytqr
    ievldntqqlkiladsinseigilcsalqkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpoA (A:)
    tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
    veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
    ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
    rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
    clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
    ytqrievldn